M6PR Antikörper

Produktnummer ABIN630460

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch M6PR in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für M6PR Antikörper (ABIN630460)

Target: M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser M6PR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-M6PR Antikörper

Aufreinigung: Purified

Immunogen: M6 PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE

Anwendungsinformationen

Applikationshinweise: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

M6PR Blocking Peptide, (ABIN5614621), is also available for use as a blocking control in assays to test for specificity of this M6PR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of M0 R antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu M6PR

Target: M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))

Andere Bezeichnung: M6PR

Hintergrund: M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.

Molekulargewicht: 28 kDa (MW of target protein)